Small nuclear ribonucleoprotein polypeptide C (Small nuclear ribonucleoprotein polypeptide C, isoform CRA_c) (cDNA, FLJ92223, Homo sapiens small nuclear ribonucleoprotein polypeptide C (SNRPC),mRNA)

UniProt : P09234, Q5TAL4, UniProt ID: Q5TAL4_HUMAN, RU1C_HUMAN,

Small nuclear ribonucleoprotein polypeptide C (Small nuclear ribonucleoprotein polypeptide C, isoform CRA_c) (cDNA, FLJ92223, Homo sapiens small nuclear ribonucleoprotein polypeptide C (SNRPC),mRNA)

Homo sapiens

MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQG
KIPPTPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAP
GMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Small nuclear ribonucleoprotein polypeptide C (Small nuclear ribonucleoprotein polypeptide C, isoform CRA_c) (cDNA, FLJ92223, Homo sapiens small nuclear ribonucleoprotein polypeptide C (SNRPC),mRNA) contains a PF06220 domain.

Small nuclear ribonucleoprotein polypeptide C (Small nuclear ribonucleoprotein polypeptide C, isoform CRA_c) (cDNA, FLJ92223, Homo sapiens small nuclear ribonucleoprotein polypeptide C (SNRPC),mRNA) is proteolytically cut by caspase () cleavage. DYCD-TYLT.