Isoform BMP1-1 of Bone morphogenetic protein 1

UniProt : P13497, UniProt ID: P13497-2,

Isoform BMP1-1 of Bone morphogenetic protein 1

Homo sapiens

MPGVARLPLLLGLLLLPRPGRPLDLADYTYDLAEEDDSEPLNYKDPCKAAAFLGDIALDE
EDLRAFQVQQAVDLRRHTARKSSIKAAVPGNTSTPSCQSTNGQPQRGACGRWRGRSRSRR
AATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVFTY
RPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDRHVSIVREN
IQPGQEYNFLKMEPQEVESLGETYDFDSIMHYARNTFSRGIFLDTIVPKYEVNGVKPPIG
QRTRLSKGDIAQARKLYKCPACGETLQDSTGNFSSPEYPNGYSAHMHCVWRISVTPGEKI
ILNFTSLDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGSKLPEPIVSTDSRLWVEFRSSS
NWVGKGFFAVYEAICGGDVKKDYGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSF
EIERHDSCAYDYLEVRDGHSESSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGF
AVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNG
SITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDVCKYDFVEVRSGLTADSK
LHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSEKRPALQPPRGRPHQLKF
RVQKRNRTPQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform BMP1-1 of Bone morphogenetic protein 1 contains a PF00008 domain.

Isoform BMP1-1 of Bone morphogenetic protein 1 contains a PF00431 domain.

Isoform BMP1-1 of Bone morphogenetic protein 1 contains a PF00431 domain.

Isoform BMP1-1 of Bone morphogenetic protein 1 contains a PF01400 domain.

Isoform BMP1-1 of Bone morphogenetic protein 1 contains a PF07645 domain.

Isoform BMP1-1 of Bone morphogenetic protein 1 contains a PF00431 domain.

Isoform BMP1-1 of Bone morphogenetic protein 1 contains a PF00431 domain.

Isoform BMP1-1 of Bone morphogenetic protein 1 contains a PF00431 domain.

Isoform BMP1-1 of Bone morphogenetic protein 1 is proteolytically cut by furin (S08.071) cleavage. RSRR-AATS.