cAMP responsive element binding protein-like 1 (CAMP responsive element binding protein-like 1, isoform CRA_c)

UniProt : B0UYX6, Q99941, UniProt ID: ATF6B_HUMAN, B0UYX6_HUMAN,

cAMP responsive element binding protein-like 1 (CAMP responsive element binding protein-like 1, isoform CRA_c)

Homo sapiens

MAELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCPEQDVPFDG
SSLDVGMDVSPSEPPWELLPIFPDLQVKSEPSSPCSSSSLSSESSRLSTEPSSEALGVGE
VLHVKTESLAPPLCLLGDDPTSSFETVQINVIPTSDDSSDVQTKIEPVSPCSSVNSEASL
LSADSSSQAFIGEEVLEVKTESLSPSGCLLWDVPAPSLGAVQISMGPSLDGSSGKALPTR
KPPLQPKPVVLTTVPMPSRAVPPSTTVLLQSLVQPPPVSPVVLIQGAIRVQPEGPAPSLP
RPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQAV
LADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFGPVSISEPP
SAPISPRMNKGEPQPRRHLLGFSEQEPVQGVEPLQGSSQGPKEPQPSPTDQPSFSNLTAF
PGGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQRAQERQKS
QPRKKSPPVKAVPIQPPGPPERDSVGQLQLYRHPDRSQPAFLDAIDRREDTFYVVSFRRD
HLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDTRVIHIKTS
TVPPSLRKQPSPTPGNATGGPLPVSAASQAHQASHQPLYLNHP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cAMP responsive element binding protein-like 1 (CAMP responsive element binding protein-like 1, isoform CRA_c) contains a PF00170 domain.

cAMP responsive element binding protein-like 1 (CAMP responsive element binding protein-like 1, isoform CRA_c) is proteolytically cut by site-1 peptidase (S08.063) cleavage. RHLL-GFSE.