PMAP: SubstrateDB : Growth differentiation factor 15 (cDNA FLJ75702, highly similar to Homo sapiens growth differentiation factor 15 (GDF15), mRNA)

Growth differentiation factor 15 (cDNA FLJ75702, highly similar to Homo sapiens growth differentiation factor 15 (GDF15), mRNA)

UniProt : Q9BWA0, UniProt ID: Q9BWA0_HUMAN,

Growth differentiation factor 15 (cDNA FLJ75702, highly similar to Homo sapiens growth differentiation factor 15 (GDF15), mRNA)

Homo sapiens

MPGQELRTVNGSQMLLVLLVLSWLPHGGALSLAEASRASFPGPSELHSEDSRFRELRKRY
EDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRL
HRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQL
ELHLRPQAARGRRRARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMC
IGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDL
LAKDCHCI

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range:	-
Cleavage position:
Cleavage residues:

Growth differentiation factor 15 (cDNA FLJ75702, highly similar to Homo sapiens growth differentiation factor 15 (GDF15), mRNA) contains a PF00019 domain.

Growth differentiation factor 15 (cDNA FLJ75702, highly similar to Homo sapiens growth differentiation factor 15 (GDF15), mRNA) is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. RAAN-MHAQ.