Thyrotropin releasing hormone

UniProt : B1WBP2, P01150, UniProt ID: B1WBP2_RAT, TRH_RAT,

Thyrotropin releasing hormone

Rattus norvegicus

MPGPWLLLALALIFTLTGIPESCALPEAAQEEGAVTPDLPGLENVQVRPERRFLWKDLQR
VRGDLGAALDSWITKRQHPGKREEEEKDIEAEERGDLGEGGAWRLHKRQHPGRRANQDKY
SWADEEDSDWMPRSWLPDFFLDSWFSDVPQVKRQHPGRRSFPWMESDVTKRQHPGRRFID
PELQRSWEEKEGEGVLMPEKRQHPGKRALGHPCGPQGTCGQTGLLQLLGDLSRGQETLVK
QSPQVEPWDKEPLEE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Thyrotropin releasing hormone contains a PF05438 domain.

Thyrotropin releasing hormone is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. ELQR-SWEE.

Thyrotropin releasing hormone is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. PERR-FLWK.

Thyrotropin releasing hormone is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. LSKR-QHPG.

Thyrotropin releasing hormone is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. EEKR-QHPG.

Thyrotropin releasing hormone is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. PEKR-QHPG.

Thyrotropin releasing hormone is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. VPKR-QHPG.

Thyrotropin releasing hormone is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. QHKR-QHPG.

Thyrotropin releasing hormone is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. FHKR-QHPG.

Thyrotropin releasing hormone is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. PERR-FLWK.