PMAP: SubstrateDB : Putative uncharacterized protein

Putative uncharacterized protein

UniProt : P05198, Q53XC0, UniProt ID: IF2A_HUMAN, Q53XC0_HUMAN,

Putative uncharacterized protein

Homo sapiens

MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNI
NRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTENMPIKINLIAPPRYVMTTT
TLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEV
DGDDDAEEMEAKAED

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range:	-
Cleavage position:
Cleavage residues:

Putative uncharacterized protein contains a PF00575 domain.

Putative uncharacterized protein contains a PF07541 domain.

Putative uncharacterized protein is proteolytically cut by caspase-8 (C14.009) cleavage. AEVD-GDDD.

Putative uncharacterized protein is proteolytically cut by caspase-10 (C14.011) cleavage. AEVD-GDDD.

Putative uncharacterized protein is proteolytically cut by caspase-6 (C14.005) cleavage. AEVD-GDDD.

Putative uncharacterized protein is proteolytically cut by caspase-3 (C14.003) cleavage. AEVD-GDDD.

Putative uncharacterized protein is proteolytically cut by () cleavage. SELS-RRRI.

Putative uncharacterized protein is proteolytically cut by caspase-3 (C14.003) cleavage. DGDD-DAEE.