cDNA FLJ76891, highly similar to Homo sapiens vascular cell adhesion molecule 1 (VCAM1), transcript variant 1, mRNA (Vascular cell adhesion molecule 1, isoform CRA_b)

UniProt : A8K6R7, P19320, UniProt ID: A8K6R7_HUMAN, VCAM1_HUMAN,

cDNA FLJ76891, highly similar to Homo sapiens vascular cell adhesion molecule 1 (VCAM1), transcript variant 1, mRNA (Vascular cell adhesion molecule 1, isoform CRA_b)

Homo sapiens

MPGKMVVILGASNILWIMFAASQAFKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWR
TQIDSPLNGKVTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPE
IHLSGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEV
TFTPVIEDIGKVLVCRAKLHIDEMDSVPTVRQAVKELQVYISPKNTVISVNPSTKLQEGG
SVTMTCSSEGLPAPEIFWSKKLDNGNLQHLSGNATLTLIAMRMEDSGIYVCEGVNLIGKN
RKEVELIVQEKPFTVEISPGPRIAAQIGDSVMLTCSVMGCESPSFSWRTQIDSPLSGKVR
SEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIEMSGGLVNGSS
VTVSCKVPSVYPLDRLEIELLKGETILENIEFLEDTDMKSLENKSLEMTFIPTIEDTGKA
LVCQAKLHIDDMEFEPKQRQSTQTLYVNVAPRDTTVLVSPSSILEEGSSVNMTCLSQGFP
APKILWSRQLPNGELQPLSENATLTLISTKMEDSGVYLCEGINQAGRSRKEVELIIQVTP
KDIKLTAFPSESVKEGDTVIISCTCGNVPETWIILKKKAETGDTVLKSIDGAYTIRKAQL
KDAGVYECESKNKVGSQLRSLTLDVQGRENNKDYFSPELLVLYFASSLIIPAIGMIIYFA
RKANMKGSYSLVEAQKSKV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ76891, highly similar to Homo sapiens vascular cell adhesion molecule 1 (VCAM1), transcript variant 1, mRNA (Vascular cell adhesion molecule 1, isoform CRA_b) contains a PF07686 domain.

cDNA FLJ76891, highly similar to Homo sapiens vascular cell adhesion molecule 1 (VCAM1), transcript variant 1, mRNA (Vascular cell adhesion molecule 1, isoform CRA_b) contains a PF07679 domain.

cDNA FLJ76891, highly similar to Homo sapiens vascular cell adhesion molecule 1 (VCAM1), transcript variant 1, mRNA (Vascular cell adhesion molecule 1, isoform CRA_b) contains a PF07679 domain.

cDNA FLJ76891, highly similar to Homo sapiens vascular cell adhesion molecule 1 (VCAM1), transcript variant 1, mRNA (Vascular cell adhesion molecule 1, isoform CRA_b) contains a PF05790 domain.

cDNA FLJ76891, highly similar to Homo sapiens vascular cell adhesion molecule 1 (VCAM1), transcript variant 1, mRNA (Vascular cell adhesion molecule 1, isoform CRA_b) contains a PF05790 domain.

cDNA FLJ76891, highly similar to Homo sapiens vascular cell adhesion molecule 1 (VCAM1), transcript variant 1, mRNA (Vascular cell adhesion molecule 1, isoform CRA_b) contains a PF00047 domain.

cDNA FLJ76891, highly similar to Homo sapiens vascular cell adhesion molecule 1 (VCAM1), transcript variant 1, mRNA (Vascular cell adhesion molecule 1, isoform CRA_b) contains a PF00047 domain.

cDNA FLJ76891, highly similar to Homo sapiens vascular cell adhesion molecule 1 (VCAM1), transcript variant 1, mRNA (Vascular cell adhesion molecule 1, isoform CRA_b) is proteolytically cut by ADAM17 peptidase (M12.217) cleavage..