Sodium channel beta-4 subunit (Sodium channel, voltage-gated, type IV, beta, isoform CRA_b) (cDNA, FLJ95353, Homo sapiens sodium channel, voltage-gated, type IV, beta (SCN4B),mRNA)

UniProt : B0YJ93, Q8IWT1, UniProt ID: B0YJ93_HUMAN, SCN4B_HUMAN,

Sodium channel beta-4 subunit (Sodium channel, voltage-gated, type IV, beta, isoform CRA_b) (cDNA, FLJ95353, Homo sapiens sodium channel, voltage-gated, type IV, beta (SCN4B),mRNA)

Homo sapiens

MPGAGDGGKAPARWLGTGLLGLFLLPVTLSLEVSVGKATDIYAVNGTEILLPCTFSSCFG
FEDLHFRWTYNSSDAFKILIEGTVKNEKSDPKVTLKDDDRITLVGSTKEKMNNISIVLRD
LEFSDTGKYTCHVKNPKENNLQHHATIFLQVVDRLEEVDNTVTLIILAVVGGVIGLLILI
LLIKKLIIFILKKTREKKKECLVSSSGNDNTENGLPGSKAEEKPPSKV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Sodium channel beta-4 subunit (Sodium channel, voltage-gated, type IV, beta, isoform CRA_b) (cDNA, FLJ95353, Homo sapiens sodium channel, voltage-gated, type IV, beta (SCN4B),mRNA) contains a PF07686 domain.

Sodium channel beta-4 subunit (Sodium channel, voltage-gated, type IV, beta, isoform CRA_b) (cDNA, FLJ95353, Homo sapiens sodium channel, voltage-gated, type IV, beta (SCN4B),mRNA) is proteolytically cut by memapsin-2 (A01.004) cleavage. TIFL-QVVD.