Creatine kinase M-type

UniProt : P04414, UniProt ID: KCRM_TORCA,

Creatine kinase M-type

Torpedo californica

MPFGNTHNKWKLNYSAAEEFPDLSKHNNHMAKALTLDIYKKLRDKETPSGFTLDDIIQTG
VDNPGHPFIMTVGCVAGDEECYEVFKDLFDPVIEDRHGGYKPTDKHKTDLNQENLKGGDD
LDPNYVLSSRVRTGRSIKGIALPPHCSRGERRLVEKLCIDGLATLTGEFQGKYYPLSSMS
DAEQQQLIDDHFLFDKPISPLLLASGMARDWPDGRGIWHNNDKTFLVWVNEEDHLRVISM
QKGGNMKEVFRRFCVGLKKIEDIFVKAGRGFMWNEHLGYVLTCPSNLGTGLRGGVHVKIP
HLCKHEKFSEVLKRTRLQKRGTGGVDTAAVGSIYDISNADRLGFSEVEQVQMVVDGVKLM
VEMEKRLENGKSIDDLMPAQK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Creatine kinase M-type contains a PF00217 domain.

Creatine kinase M-type contains a PF02807 domain.

Creatine kinase M-type is proteolytically cut by omptin (A26.001) cleavage. DIYK-KLRD.