Ips-1 protein (Virus-induced signaling adapter, isoform CRA_a)

UniProt : Q2HWT5, Q7Z434, UniProt ID: MAVS_HUMAN, Q2HWT5_HUMAN,

Ips-1 protein (Virus-induced signaling adapter, isoform CRA_a)

Homo sapiens

MPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFN
TLQRRPGWVEYFIAALRGCELVDLADEVASVYQSYQPRTSDRPPDPLEPPSLPAERPGPP
TPAAAHSIPYNSCREKEPSYPMPVQETQAPESPGENSEQALQTLSPRAIPRNPDGGPLES
SSDLAALSPLTSSGHQEQDTELGSTHTAGATSSLTPSRGPVSPSVSFQPLARSTPRASRL
PGPTGSVVSTGTSFSSSSPGLASAGAAEGKQGAESDQAEPIICSSGAEAPANSLPSKVPT
TLMPVNTVALKVPANPASVSTVPSKLPTSSKPPGAVPSNALTNPAPSKLPINSTRAGMVP
SKVPTSMVLTKVSASTVPTDGSSRNEETPAAPTPAGATGGSSAWLDSSSENRGLGSELSK
PGVLASQVDSPFSGCFEDLAISASTSLGMGPCHGPEENEYKSEGTFGIHVAENPSIQLLE
GNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQVAVTGVLVVTLLVVLYRRRLH

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Ips-1 protein (Virus-induced signaling adapter, isoform CRA_a) is proteolytically cut by caspase () cleavage. ADPD-GGPR.

Ips-1 protein (Virus-induced signaling adapter, isoform CRA_a) is proteolytically cut by caspase () cleavage. ADPD-GGPR.

Ips-1 protein (Virus-induced signaling adapter, isoform CRA_a) is proteolytically cut by hepacivirin (S29.001) cleavage. EVPC-HRPS.