cDNA, FLJ92961, highly similar to Homo sapiens chaperonin containing TCP1, subunit 4 (delta) (CCT4),mRNA

UniProt : B2R6I3, P50991, UniProt ID: B2R6I3_HUMAN, TCPD_HUMAN,

cDNA, FLJ92961, highly similar to Homo sapiens chaperonin containing TCP1, subunit 4 (delta) (CCT4),mRNA

Homo sapiens

MPENVAPRSGATAGAAGGRGKGAYQDRDKPAQIRFSNISAAKAVADAIRTSLGPKGMDKM
IQDGKGDVTITNDGATILKQMQVLHPAARMLVELSKAQDIEAGDGTTSVVIIAGSLLDSC
TKLLQKGIHPTIISESFQKALEKGIEILTDMSRPVELSDRETLLNSATTSLNSKVVSQYS
SLLSPMSVNAVMKVIDPATATSVDLRDIKIVKKLGGTIDDCELVEGLVLTQKVSNSGITR
VEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERAYILNLVKQIKKTGCNVLLI
QKSILRDALSDLALHFLNKMKIMVIKDIEREDIEFICKTIGTKPVAHIDQFTADMLGSAE
LAEEVNLNGSGKLLKITGCASPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRA
LIAGGGAPEIELALRLTEYSRTLSGMESYCVRAFADAMEVIPSTLAENAGLNPISTVTEL
RNRHAQGEKTAGINVRKGGISNILEELVVQPLLVSVSALTLATETVRSILKIDDVVNTR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ92961, highly similar to Homo sapiens chaperonin containing TCP1, subunit 4 (delta) (CCT4),mRNA contains a PF00118 domain.

cDNA, FLJ92961, highly similar to Homo sapiens chaperonin containing TCP1, subunit 4 (delta) (CCT4),mRNA is proteolytically cut by caspase () cleavage. VVSD-YAQM.