SpoIVB peptidase

UniProt : P17896, UniProt ID: SP4B_BACSU,

SpoIVB peptidase

Bacillus subtilis

MPDNIRKAVGLILLVSLLSVGLCKPLKEYLLIPTQMRVFETQTQAIETSLSVNAQTSESS
EAFTVKKDPHEIKVTGKKSGESELVYDLAGFPIKKTKVHVLPDLKVIPGGQSIGVKLHSV
GVLVGFHQINTSEGKKSPGETAGIEAGDIIIEMNGQKIEKMNDVAPFIQKAGKTGESLDL
LIKRDKQKIKTKLIPEKDEGEGKYRIGLYIRDSAAGIGTMTFYEPKTKKYGALGHVISDM
DTKKPIVVENGEIVKSTVTSIEKGTGGNPGEKLARFSSERKTIGDINRNSPFGIFGTLHQ
PIQNNISDQALPVAFSTEVKKGPAEILTVIDDDKVEKFDIEIVSTTPQKFPATKGMVLKI
TDPRLLKETGGIVQGMSGSPIIQNGKVIGAVTHVFVNDPTSGYGVHIEWMLSEAGIDIYG
KEKAS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

SpoIVB peptidase contains a PF00595 domain.

SpoIVB peptidase contains a PF05580 domain.

SpoIVB peptidase is proteolytically cut by SpoIVB peptidase (S55.001) cleavage. IKVT-GKKS.

SpoIVB peptidase is proteolytically cut by SpoIVB peptidase (S55.001) cleavage. SEAF-TVKK.

SpoIVB peptidase is proteolytically cut by SpoIVB peptidase (S55.001) cleavage. LSVN-AQTS.

SpoIVB peptidase is proteolytically cut by SpoIVB peptidase (S55.001) cleavage..