Cytoplasmic protein NCK1

UniProt : P16333, UniProt ID: NCK1_HUMAN,

Cytoplasmic protein NCK1

Homo sapiens

MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKN
SARKASIVKNLKDTLGIGKVKRKPSVPDSASPADDSFVDPGERLYDLNMPAYVKFNYMAE
REDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGDSPLGDHVGSLSEKLA
AVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVG
LVPKNYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERG
HEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKAP
IFTSEQGEKLYLVKHLS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Cytoplasmic protein NCK1 contains a PF00018 domain.

Cytoplasmic protein NCK1 contains a PF00018 domain.

Cytoplasmic protein NCK1 contains a PF00018 domain.

Cytoplasmic protein NCK1 contains a PF00017 domain.

Cytoplasmic protein NCK1 is proteolytically cut by caspase-3 (C14.003) cleavage..

Cytoplasmic protein NCK1 is proteolytically cut by caspase-3 (C14.003) cleavage. SVPD-SASP.