Vasopressin-neurophysin 2-copeptin

UniProt : P01183, UniProt ID: NEU2_PIG,

Vasopressin-neurophysin 2-copeptin

Sus scrofa

MPDATLPACFLGLLALTSACYFQNCPKGGKRAMSDLELRQCLPCGPGGKGRCFGPSICCG
DELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCNDESCVTEPECREGA
SFLRRARASDRSNATLLDGPSGALLLRLVQLAGAPEPAEPAQPGVY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Vasopressin-neurophysin 2-copeptin contains a PF00184 domain.

Vasopressin-neurophysin 2-copeptin contains a PF00220 domain.

Vasopressin-neurophysin 2-copeptin is proteolytically cut by prolyl oligopeptidase (S09.001) cleavage. QNCP-RG--.

Vasopressin-neurophysin 2-copeptin is proteolytically cut by cystinyl aminopeptidase (M01.011) cleavage. ---C-YFQN.