Isoform 2 of Protein-glutamine gamma-glutamyltransferase 2

UniProt : P21980, UniProt ID: P21980-2,

Isoform 2 of Protein-glutamine gamma-glutamyltransferase 2

Homo sapiens

MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFS
VVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLE
ASTGYQGSSFVLGHFILLFNAWCPADAVYLDSEEERQEYVLTQQGFIYQGSAKFIKNIPW
NFGQFEDGILDICLILLDVNPKFLKNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGR
WDNNYGDGVSPMSWIGSVDILRRWKNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIQQDDGSVHKSINRSL
IVGLKISTKSVGRDEREDITHTYKYPEGSSEEREAFTRANHLNKLAEKEETGMAMRIRVG
QSMNMGSDFDVFAHITNNTAEEYVCRLLLCARTVSYNGILGPECGTKYLLNLNLEPFSGK
ALCSWSIC

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform 2 of Protein-glutamine gamma-glutamyltransferase 2 contains a PF00868 domain.

Isoform 2 of Protein-glutamine gamma-glutamyltransferase 2 contains a PF01841 domain.

Isoform 2 of Protein-glutamine gamma-glutamyltransferase 2 contains a PF00927 domain.

Isoform 2 of Protein-glutamine gamma-glutamyltransferase 2 contains a PF00927 domain.

Isoform 2 of Protein-glutamine gamma-glutamyltransferase 2 is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. GPVP-VRAI.

Isoform 2 of Protein-glutamine gamma-glutamyltransferase 2 is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. AFTR-ANHL.

Isoform 2 of Protein-glutamine gamma-glutamyltransferase 2 is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. RANH-LNKL.