Activating signal cointegrator 1 complex subunit 2

UniProt : Q5NCK0, Q91WR3, UniProt ID: ASCC2_MOUSE, Q5NCK0_MOUSE,

Activating signal cointegrator 1 complex subunit 2

Mus musculus

MPALPLDQLQITHKDPKTGQPKTSAALNPEQKADRYFVLYKPPPKDNIPALVEEYLERAN
FVANDLDWLLALPHDKFWCQVIFDETLQKCLDSYLHYVPRKFDEWVAPTPEVADMQNHLH
RSVFLTFLRMSTHKESKDHFISPSAFGEILYNNFLFDIPKILDLCVLFGKGNSPLLQKMI
GNIFTQQPSYYTDLDETIPTILQVFSNILQHCGLQGDGTSTTPQKLGERSPLTPSDMPLL
ELKDIVLYLCDTSTTLWAFLDIFPLACQTFQKHDFCYRLASFYEMAIPELESAIKKRRLE
DSKLLGDMWQRLSHSKKKLMEVFHIILNQICLLPILESSCDNIQGFIEEFLQIFSSLLQE
KRFLRDYDTFSPVAEDISLLQQASSALDETRTAYILQAVESAWEGVDRQKIKDIKDPPRA
KGSNNEVTVTAEPVSEMPSQLENLEEDEECMGAAAALGPAVSGVELDSLISQVKDLLPDL
GEGFILACLEHYSYDSEQVINNILEDRLAPELSQLDRGLERQVKPDPTPLLSSRHNIFQN
DEFDVFSRDSVDLSRVHKGRRKEENVRSLVNDKQAVVAQWQRYQKYSVVVEEVPLQPGEY
QADDYEDEYDDTYDGNQVGANDADSDDELISRRPFTIPQVLRTKMPGEVQEEEWDEEDEV
EEEAPKPDHFIQDPAVLREKAEARRMAFLARKGYRPENSTAVTGGPRGHGQSRETTQERR
KKEANKAARANHNRRTMADRKRSKGMIPS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Activating signal cointegrator 1 complex subunit 2 contains a PF02845 domain.

Activating signal cointegrator 1 complex subunit 2 is proteolytically cut by caspase-1 (C14.001) cleavage. DTYD-GNQV.

Activating signal cointegrator 1 complex subunit 2 is proteolytically cut by caspase-1 (C14.001) cleavage. YDGN-QVGA.