Ameloblastin

UniProt : Q28989, UniProt ID: AMBN_PIG,

Ameloblastin

Sus scrofa

MPALKIPLFKMKDMVLILCLLKMSSAVPAFPRQPGTPGVASLSLETMRQLGSLQGLNMLS
QYSRFGFGKSFNSLWMHGLLPPHSSFQWMRPREHETQQYEYSLPVHPPPLPSQPSLQPQQ
PGQKPFLQPTVVTSIQNPVQKGVPQPPIYQGHPPLQQVEGPMVQQQVAPSEKPPEAELPG
LDFADPQDPSMFPIARLISQGPVPQDKPSPLYPGMFYMSYGANQLNSPARLGILSSEEMA
GGRGGPLAYGAMFPGFGGMRPNLGGMPPNSAKGGDFTLEFDSPAAGTKGPEKGEGGAEGS
PVAEANTADPESPALFSEVASGVLGGLLANPKGKIPNLARGPAGRSRGPPGVTPADADPL
MTPGLADAYETYGADETTTLGLQEEMTMDSTATPYSEHTSMPGNKAQQPQIKRDAWRFQE
P

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Ameloblastin contains a PF05111 domain.

Ameloblastin is proteolytically cut by matrix metallopeptidase-20 (M10.019) cleavage. SAVP-AFPR.

Ameloblastin is proteolytically cut by matrix metallopeptidase-20 (M10.019) cleavage. QGLN-MLSQ.

Ameloblastin is proteolytically cut by matrix metallopeptidase-20 (M10.019) cleavage. PPLQ-QVEG.

Ameloblastin is proteolytically cut by matrix metallopeptidase-20 (M10.019) cleavage. MVQQ-QVAP.

Ameloblastin is proteolytically cut by matrix metallopeptidase-20 (M10.019) cleavage. PIAR-LISQ.

Ameloblastin is proteolytically cut by matrix metallopeptidase-20 (M10.019) cleavage. GPLA-YGAM.

Ameloblastin is proteolytically cut by matrix metallopeptidase-20 (M10.019) cleavage. VLGG-LLAN.

Ameloblastin is proteolytically cut by matrix metallopeptidase-20 (M10.019) cleavage. PAGR-SRGP.

Ameloblastin is proteolytically cut by matrix metallopeptidase-20 (M10.019) cleavage. LADA-YETY.