Sodium channel beta-3 subunit (cDNA, FLJ95332, Homo sapiens voltage-gated sodium channel beta-3 subunit (scn3b gene) (HSA243396), mRNA)

UniProt : A5H1I5, Q9NY72, UniProt ID: A5H1I5_HUMAN, SCN3B_HUMAN,

Sodium channel beta-3 subunit (cDNA, FLJ95332, Homo sapiens voltage-gated sodium channel beta-3 subunit (scn3b gene) (HSA243396), mRNA)

Homo sapiens

MPAFNRLFPLASLVLIYWVSVCFPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVV
EWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLNDSGLYTC
NVSREFEFEAHRPFVKTTRLIPLRVTEEAGEDFTSVVSEIMMYILLVFLTLWLLIEMIYC
YRKVSKAEEAAQENASDYLAIPSENKENSAVPVEE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Sodium channel beta-3 subunit (cDNA, FLJ95332, Homo sapiens voltage-gated sodium channel beta-3 subunit (scn3b gene) (HSA243396), mRNA) contains a PF07686 domain.

Sodium channel beta-3 subunit (cDNA, FLJ95332, Homo sapiens voltage-gated sodium channel beta-3 subunit (scn3b gene) (HSA243396), mRNA) is proteolytically cut by memapsin-2 (A01.004) cleavage. EFEF-EAHR.

Sodium channel beta-3 subunit (cDNA, FLJ95332, Homo sapiens voltage-gated sodium channel beta-3 subunit (scn3b gene) (HSA243396), mRNA) is proteolytically cut by memapsin-2 (A01.004) cleavage. GEDF-TSVV.