Putative uncharacterized protein

UniProt : P21980, Q6B838, UniProt ID: Q6B838_HUMAN, TGM2_HUMAN,

Putative uncharacterized protein

Homo sapiens

MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFS
VVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLE
ASTGYQGSSFVLGHFILLFNAWCPADAVYLDSEEERQEYVLTQQGFIYQGSAKFIKNIPW
NFGQFEDGILDICLILLDVNPKFLKNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGR
WDNNYGDGVSPMSWIGSVDILRRWKNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIQQDDGSVHKSINRSL
IVGLKISTKSVGRDEREDITHTYKYPEGSSEEREAFTRANHLNKLAEKEETGMAMRIRVG
QSMNMGSDFDVFAHITNNTAEEYVCRLLLCARTVSYNGILGPECGTKYLLNLNLEPFSEK
SVPLCILYEKYRDCLTESNLIKVRALLVEPVINSYLLAERDLYLENPEIKIRILGEPKQK
RKLVAEVSLQNPLPVALEGCTFTVEGAGLTEEQKTVEIPDPVEAGEEVKVRMDLLPLHMG
LHKLVVNFESDKLKAVKGFRNVIIGPA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein contains a PF00868 domain.

Putative uncharacterized protein contains a PF00927 domain.

Putative uncharacterized protein contains a PF00927 domain.

Putative uncharacterized protein contains a PF01841 domain.

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. GPVP-VRAI.

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. AFTR-ANHL.

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. RANH-LNKL.

Putative uncharacterized protein is proteolytically cut by caspase-3 (C14.003) cleavage..