Gap junction protein

UniProt : A2AGI4, P28230, UniProt ID: A2AGI4_MOUSE, CXB1_MOUSE,

Gap junction protein

Mus musculus

MNWTGLYTLLSGVNRHSTAIGRVWLSVIFIFRIMVLVVAAESVWGDEKSSFICNTLQPGC
NSVCYDHFFPISHVRLWSLQLILVSTPALLVAMHVAHQQHIEKKMLRLEGHGDPLHLEEV
KRHKVHISGTLWWTYVISVVFRLLFEAVFMYVFYLLYPGYAMVRLVKCEAFPCPNTVDCF
VSRPTEKTVFTVFMLAASGICIILNVAEVVYLIIRACARRAQRRSNPPSRKGSGFGHRLS
PEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Gap junction protein contains a PF00029 domain.

Gap junction protein is proteolytically cut by calpain (C02.001) cleavage..

Gap junction protein is proteolytically cut by calpain-2 (C02.002) cleavage..

Gap junction protein is proteolytically cut by calpain (C02.001) cleavage..

Gap junction protein is proteolytically cut by calpain-2 (C02.002) cleavage..

Gap junction protein is proteolytically cut by calpain-1 (C02.001) cleavage..

Gap junction protein is proteolytically cut by calpain-2 (C02.002) cleavage..