Putative uncharacterized protein SERPINE2 (Serpin peptidase inhibitor, clade E (Nexin, plasminogen activator inhibitor type 1), member 2, isoform CRA_a)

UniProt : P07093, Q53S15, UniProt ID: GDN_HUMAN, Q53S15_HUMAN,

Putative uncharacterized protein SERPINE2 (Serpin peptidase inhibitor, clade E (Nexin, plasminogen activator inhibitor type 1), member 2, isoform CRA_a)

Homo sapiens

MNWHLPLFLLASVTLPSICSHFNPLSLEELGSNTGIQVFNQIVKSRPHDNIVISPHGIAS
VLGMLQLGADGRTKKQLAMVMRYGVNGVGKILKKINKAIVSKKNKDIVTVANAVFVKNAS
EIEVPFVTRNKDVFQCEVRNVNFEDPASACDSINAWVKNETRDMIDNLLSPDLIDGVLTR
LVLVNAVYFKGLWKSRFQPENTKKRTFVAADGKSYQVPMLAQLSVFRCGSTSAPNDLWYN
FIELPYHGESISMLIALPTESSTPLSAIIPHISTKTIDSWMSIMVPKRVQVILPKFTAVA
QTDLKEPLKVLGITDMFDSSKANFAKITTGSENLHVSHILQKAKIEVSEDGTKASAATTA
ILIARSSPPWFIVDRPFLFFIRHNPTGAVLFMGQINKP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein SERPINE2 (Serpin peptidase inhibitor, clade E (Nexin, plasminogen activator inhibitor type 1), member 2, isoform CRA_a) contains a PF00079 domain.

Putative uncharacterized protein SERPINE2 (Serpin peptidase inhibitor, clade E (Nexin, plasminogen activator inhibitor type 1), member 2, isoform CRA_a) is proteolytically cut by () cleavage..

Putative uncharacterized protein SERPINE2 (Serpin peptidase inhibitor, clade E (Nexin, plasminogen activator inhibitor type 1), member 2, isoform CRA_a) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. NKDI-VTVA.