Eukaryotic translation initiation factor 4 gamma 3

UniProt : O43432, UniProt ID: IF4G3_HUMAN,

Eukaryotic translation initiation factor 4 gamma 3

Homo sapiens

MNSQPQTRSPFFQRPQIQPPRATIPNSSPSIRPGAQTPTAVYQANQHIMMVNHLPMPYPV
PQGPQYCIPQYRHSGPPYVGPPQQYPVQPPGPGPFYPGPGPGDFPNAYGTPFYPSQPVYQ
SAPIIVPTQQQPPPAKREKKTIRIRDPNQGGKDITEEIMSGGGSRNPTPPIGRPTSTPTP
PQQLPSQVPEHSPVVYGTVESAHLAASTPVTAASDQKQEEKPKPDPVLKSPSPVLRLVLS
GEKKEQEGQTSETTAIVSIAELPLPPSPTTVSSVARSTIAAPTSSALSSQPIFTTAIDDR
CELSSPREDTIPIPSLTSCTETSDPLPTNENDDDICKKPCSVAPNDIPLVSSTNLINEIN
GVSEKLSATESIVEIVKQEVLPLTLELEILENPPEEMKLECIPAPITPSTVPSFPPTPPT
PPASPPHTPVIVPAAATTVSSPSAAITVQRVLEEDESIRTCLSEDAKEIQNKIEVEADGQ
TEEILDSQNLNSRRSPVPAQIAITVPKTWKKPKDRTRTTEEMLEAELELKAEEELSIDKV
LESEQDKMSQGFHPERDPSDLKKVKAVEENGEEAEPVRNGAESVSEGEGIDANSGSTDSS
GDGVTFPFKPESWKPTDTEGKKQYDREFLLDFQFMPACIQKPEGLPPISDVVLDKINQPK
LPMRTLDPRILPRGPDFTPAFADFGRQTPGGRGVPLLNVGSRRSQPGQRREPRKIITVSV
KEDVHLKKAENAWKPSQKRDSQADDPENIKTQELFRKVRSILNKLTPQMFNQLMKQVSGL
TVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPGNTVNFRKLLLNR
CQKEFEKDKADDDVFEKKQKELEAASAPEERTRLHDELEEAKDKARRRSIGNIKFIGELF
KLKMLTEAIMHDCVVKLLKNHDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIV
KERKTSSRIRFMLQDVIDLRLCNWVSRRADQGPKTIEQIHKEAKIEEQEEQRKVQQLMTK
EKRRPGVQRVDEGGWNTVQGAKNSRVLDPSKFLKITKPTIDEKIQLVPKAQLGSWGKGSS
GGAKASETDALRSSASSLNRFSALQPPAPSGSTPSTPVEFDSRRTLTSRGSMGREKNDKP
LPSATARPNTFMRGGSSKDLLDNQSQEEQRREMLETVKQLTGGVDVERNSTEAERNKTRE
SAKPEISAMSAHDKAALSEEELERKSKSIIDEFLHINDFKEAMQCVEELNAQGLLHVFVR
VGVESTLERSQITRDHMGQLLYQLVQSEKLSKQDFFKGFSETLELADDMAIDIPHIWLYL
AELVTPMLKEGGISMRELTIEFSKPLLPVGRAGVLLSEILHLLCKQMSHKKVGALWREAD
LSWKDFLPEGEDVHNFLLEQKLDFIESDSPCSSEALSKKELSAEELYKRLEKLIIEDKAN
DEQIFDWVEANLDEIQMSSPTFLRALMTAVCKAAIIADSSTFRVDTAVIKQRVPILLKYL
DSDTEKELQALYALQASIVKLDQPANLLRMFFDCLYDEEVISEDAFYKWESSKDPAEQNG
KGVALKSVTAFFTWLREAEEESEDN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Eukaryotic translation initiation factor 4 gamma 3 contains a PF02020 domain.

Eukaryotic translation initiation factor 4 gamma 3 contains a PF02847 domain.

Eukaryotic translation initiation factor 4 gamma 3 contains a PF02854 domain.

Eukaryotic translation initiation factor 4 gamma 3 is proteolytically cut by Leader proteinase (C28.001) cleavage. LNVG-SRRS.

Eukaryotic translation initiation factor 4 gamma 3 is proteolytically cut by Leader proteinase (C28.001) cleavage. ADFG-RQTP.

Eukaryotic translation initiation factor 4 gamma 3 is proteolytically cut by rhinovirus picornain 2A (C03.021) cleavage. PGGR-GVPL.

Eukaryotic translation initiation factor 4 gamma 3 is proteolytically cut by Leader proteinase (C28.001) cleavage. LNVG-SRRS.

Eukaryotic translation initiation factor 4 gamma 3 is proteolytically cut by Leader proteinase (C28.001) cleavage. ADFG-RQTP.

Eukaryotic translation initiation factor 4 gamma 3 is proteolytically cut by rhinovirus picornain 2A (C03.021) cleavage. PGGR-GVPL.

Eukaryotic translation initiation factor 4 gamma 3 is proteolytically cut by coxsackievirus-type picornain 2A (C03.022) cleavage. PGGR-GVPL.

Eukaryotic translation initiation factor 4 gamma 3 is proteolytically cut by rhinovirus picornain 2A (C03.021) cleavage. LLNV-GSRR.