Metastasis-suppressor KiSS-1

UniProt : Q15726, UniProt ID: KISS1_HUMAN,

Metastasis-suppressor KiSS-1

Homo sapiens

MNSLVSWQLLLFLCATHFGEPLEKVASVGNSRPTGQQLESLGLLAPGEQSLPCTERKPAA
TARLSRRGTSLSPPPESSGSPQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLR
FGKREAAPGNHGRSAGRGWGAGAGQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Metastasis-suppressor KiSS-1 is proteolytically cut by membrane-type matrix metallopeptidase-5 (M10.023) cleavage. NSFG-LRFG.

Metastasis-suppressor KiSS-1 is proteolytically cut by membrane-type matrix metallopeptidase-3 (M10.016) cleavage. NSFG-LRFG.

Metastasis-suppressor KiSS-1 is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. NSFG-LRFG.

Metastasis-suppressor KiSS-1 is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. NSFG-LRFG.

Metastasis-suppressor KiSS-1 is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. NSFG-LRFG.