CCK protein (Cholecystokinin, isoform CRA_a) (cDNA FLJ76519, highly similar to Homo sapiens cholecystokinin (CCK), mRNA) (Cholecystokinin) (Fragment)

UniProt : P06307, Q6FG82, UniProt ID: CCKN_HUMAN, Q6FG82_HUMAN,

CCK protein (Cholecystokinin, isoform CRA_a) (cDNA FLJ76519, highly similar to Homo sapiens cholecystokinin (CCK), mRNA) (Cholecystokinin) (Fragment)

Homo sapiens

MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGA
LLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

CCK protein (Cholecystokinin, isoform CRA_a) (cDNA FLJ76519, highly similar to Homo sapiens cholecystokinin (CCK), mRNA) (Cholecystokinin) (Fragment) contains a PF00918 domain.

CCK protein (Cholecystokinin, isoform CRA_a) (cDNA FLJ76519, highly similar to Homo sapiens cholecystokinin (CCK), mRNA) (Cholecystokinin) (Fragment) is proteolytically cut by aminopeptidase A (M01.003) cleavage. SDRD-YMGW.

CCK protein (Cholecystokinin, isoform CRA_a) (cDNA FLJ76519, highly similar to Homo sapiens cholecystokinin (CCK), mRNA) (Cholecystokinin) (Fragment) is proteolytically cut by meprin beta subunit (M12.004) cleavage. MGWM-DFGR.

CCK protein (Cholecystokinin, isoform CRA_a) (cDNA FLJ76519, highly similar to Homo sapiens cholecystokinin (CCK), mRNA) (Cholecystokinin) (Fragment) is proteolytically cut by meprin alpha subunit (M12.002) cleavage. YMGW-MDFG.

CCK protein (Cholecystokinin, isoform CRA_a) (cDNA FLJ76519, highly similar to Homo sapiens cholecystokinin (CCK), mRNA) (Cholecystokinin) (Fragment) is proteolytically cut by meprin alpha subunit (M12.002) cleavage. GWMD-FGRR.

CCK protein (Cholecystokinin, isoform CRA_a) (cDNA FLJ76519, highly similar to Homo sapiens cholecystokinin (CCK), mRNA) (Cholecystokinin) (Fragment) is proteolytically cut by carboxypeptidase E (M14.005) cleavage. MDFG-RRSA.

CCK protein (Cholecystokinin, isoform CRA_a) (cDNA FLJ76519, highly similar to Homo sapiens cholecystokinin (CCK), mRNA) (Cholecystokinin) (Fragment) is proteolytically cut by carboxypeptidase E (M14.005) cleavage. MDFG-RRSA.