Putative uncharacterized protein IL6 (Interleukin 6 (Interferon, beta 2), isoform CRA_a) (Interleukin 6) (Interferon, beta 2) (IL6 protein)

UniProt : P05231, Q75MH2, UniProt ID: IL6_HUMAN, Q75MH2_HUMAN,

Putative uncharacterized protein IL6 (Interleukin 6 (Interferon, beta 2), isoform CRA_a) (Interleukin 6) (Interferon, beta 2) (IL6 protein)

Homo sapiens

MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI
LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL
EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ
AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein IL6 (Interleukin 6 (Interferon, beta 2), isoform CRA_a) (Interleukin 6) (Interferon, beta 2) (IL6 protein) contains a PF00489 domain.

Putative uncharacterized protein IL6 (Interleukin 6 (Interferon, beta 2), isoform CRA_a) (Interleukin 6) (Interferon, beta 2) (IL6 protein) is proteolytically cut by trepolisin (S08.024) cleavage..

Putative uncharacterized protein IL6 (Interleukin 6 (Interferon, beta 2), isoform CRA_a) (Interleukin 6) (Interferon, beta 2) (IL6 protein) is proteolytically cut by trepolisin (S08.024) cleavage..

Putative uncharacterized protein IL6 (Interleukin 6 (Interferon, beta 2), isoform CRA_a) (Interleukin 6) (Interferon, beta 2) (IL6 protein) is proteolytically cut by gingipain K (C25.002) cleavage. RSFK-EFLQ.

Putative uncharacterized protein IL6 (Interleukin 6 (Interferon, beta 2), isoform CRA_a) (Interleukin 6) (Interferon, beta 2) (IL6 protein) is proteolytically cut by gingipain R (C25.001) cleavage. APHR-QPLT.

Putative uncharacterized protein IL6 (Interleukin 6 (Interferon, beta 2), isoform CRA_a) (Interleukin 6) (Interferon, beta 2) (IL6 protein) is proteolytically cut by gingipain R (C25.001) cleavage. SSLR-ALRQ.