PDGFB protein (Platelet-derived growth factor beta polypeptide (Simian sarcoma viral (V-sis) oncogene homolog), isoform CRA_b)

UniProt : P01127, Q6FHE7, UniProt ID: PDGFB_HUMAN, Q6FHE7_HUMAN,

PDGFB protein (Platelet-derived growth factor beta polypeptide (Simian sarcoma viral (V-sis) oncogene homolog), isoform CRA_b)

Homo sapiens

MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAEL
DLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLV
WPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKC
ETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLG
A

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

PDGFB protein (Platelet-derived growth factor beta polypeptide (Simian sarcoma viral (V-sis) oncogene homolog), isoform CRA_b) contains a PF00341 domain.

PDGFB protein (Platelet-derived growth factor beta polypeptide (Simian sarcoma viral (V-sis) oncogene homolog), isoform CRA_b) contains a PF04692 domain.

PDGFB protein (Platelet-derived growth factor beta polypeptide (Simian sarcoma viral (V-sis) oncogene homolog), isoform CRA_b) is proteolytically cut by furin (S08.071) cleavage. RGRR-SLGS.

PDGFB protein (Platelet-derived growth factor beta polypeptide (Simian sarcoma viral (V-sis) oncogene homolog), isoform CRA_b) is proteolytically cut by proprotein convertase 5 (S08.076) cleavage. RGRR-SLGS.

PDGFB protein (Platelet-derived growth factor beta polypeptide (Simian sarcoma viral (V-sis) oncogene homolog), isoform CRA_b) is proteolytically cut by proprotein convertase 7 (S08.077) cleavage. RGRR-SLGS.

PDGFB protein (Platelet-derived growth factor beta polypeptide (Simian sarcoma viral (V-sis) oncogene homolog), isoform CRA_b) is proteolytically cut by PACE4 proprotein convertase (S08.075) cleavage. RGRR-SLGS.

PDGFB protein (Platelet-derived growth factor beta polypeptide (Simian sarcoma viral (V-sis) oncogene homolog), isoform CRA_b) is proteolytically cut by furin (S08.071) cleavage. RPVT-RSPG.

PDGFB protein (Platelet-derived growth factor beta polypeptide (Simian sarcoma viral (V-sis) oncogene homolog), isoform CRA_b) is proteolytically cut by proprotein convertase 5 (S08.076) cleavage. RPVT-RSPG.

PDGFB protein (Platelet-derived growth factor beta polypeptide (Simian sarcoma viral (V-sis) oncogene homolog), isoform CRA_b) is proteolytically cut by proprotein convertase 7 (S08.077) cleavage. RPVT-RSPG.

PDGFB protein (Platelet-derived growth factor beta polypeptide (Simian sarcoma viral (V-sis) oncogene homolog), isoform CRA_b) is proteolytically cut by PACE4 proprotein convertase (S08.075) cleavage. RPVT-RSPG.