|
Homo sapiens MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRV EIIATMKKKGEKRCLNPESKAIKNLLKAVSKEMSKRSP The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
is proteolytically cut by dipeptidyl-peptidase IV (S09.003) cleavage. QGVP-LSRT.
is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. LKAV-SKEM.
is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. VSKE-MSKR.
is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. KEMS-KRSP.