Isoform 2 of Nuclear factor NF-kappa-B p105 subunit

UniProt : P19838, UniProt ID: P19838-2,

Isoform 2 of Nuclear factor NF-kappa-B p105 subunit

Homo sapiens

MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTADGPYLQILEQPKQRGFRFRY
VCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCE
DGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQ
AEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAI
YDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGD
FSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEV
QRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITF
HPGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNG
EVTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQ
DENGDSVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVE
DLLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKKAALLLDHPNGDGLNAIHLAM
MSNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDG
TTPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMA
TSWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKL
GLGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTS
QAHSLPLSPASTRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYG
QEGPLEGKI

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform 2 of Nuclear factor NF-kappa-B p105 subunit contains a PF00023 domain.

Isoform 2 of Nuclear factor NF-kappa-B p105 subunit contains a PF00023 domain.

Isoform 2 of Nuclear factor NF-kappa-B p105 subunit contains a PF00023 domain.

Isoform 2 of Nuclear factor NF-kappa-B p105 subunit contains a PF00023 domain.

Isoform 2 of Nuclear factor NF-kappa-B p105 subunit contains a PF00023 domain.

Isoform 2 of Nuclear factor NF-kappa-B p105 subunit contains a PF00023 domain.

Isoform 2 of Nuclear factor NF-kappa-B p105 subunit contains a PF00531 domain.

Isoform 2 of Nuclear factor NF-kappa-B p105 subunit contains a PF00554 domain.

Isoform 2 of Nuclear factor NF-kappa-B p105 subunit contains a PF01833 domain.

Isoform 2 of Nuclear factor NF-kappa-B p105 subunit is proteolytically cut by caspase-3 (C14.003) cleavage..