Polyadenylate-binding protein 1

UniProt : P11940, UniProt ID: PABP1_HUMAN,

Polyadenylate-binding protein 1

Homo sapiens

MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQ
QPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFS
AFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKERE
AELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFER
HEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQGVNLYVKN
LDDGIDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVAT
KPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRA
AYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQ
RVANTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQ
GQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESP
ESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Polyadenylate-binding protein 1 contains a PF00076 domain.

Polyadenylate-binding protein 1 contains a PF00076 domain.

Polyadenylate-binding protein 1 contains a PF00076 domain.

Polyadenylate-binding protein 1 contains a PF00076 domain.

Polyadenylate-binding protein 1 contains a PF00658 domain.

Polyadenylate-binding protein 1 is proteolytically cut by coxsackievirus-type picornain 2A (C03.022) cleavage. TQTM-GPRP.

Polyadenylate-binding protein 1 is proteolytically cut by poliovirus-type picornain 2A (C03.020) cleavage. TQTM-GPRP.

Polyadenylate-binding protein 1 is proteolytically cut by poliovirus-type picornain 3C (C03.001) cleavage. VHVQ-GQEP.

Polyadenylate-binding protein 1 is proteolytically cut by poliovirus-type picornain 3C (C03.001) cleavage. WTAQ-GARP.

Polyadenylate-binding protein 1 is proteolytically cut by poliovirus-type picornain 3C (C03.001) cleavage. AIPQ-TQNR.