cDNA, FLJ92487, Homo sapiens protease, serine, 1 (trypsin 1) (PRSS1), mRNA

UniProt : B2R5I5, P07477, UniProt ID: B2R5I5_HUMAN, TRY1_HUMAN,

cDNA, FLJ92487, Homo sapiens protease, serine, 1 (trypsin 1) (PRSS1), mRNA

Homo sapiens

MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ92487, Homo sapiens protease, serine, 1 (trypsin 1) (PRSS1), mRNA contains a PF00089 domain.

cDNA, FLJ92487, Homo sapiens protease, serine, 1 (trypsin 1) (PRSS1), mRNA is proteolytically cut by chymotrypsin C (S01.157) cleavage. IEVL-EGNE.

cDNA, FLJ92487, Homo sapiens protease, serine, 1 (trypsin 1) (PRSS1), mRNA is proteolytically cut by chymotrypsin C (S01.157) cleavage. IEVL-EGNE.

cDNA, FLJ92487, Homo sapiens protease, serine, 1 (trypsin 1) (PRSS1), mRNA is proteolytically cut by penicillopepsin (A01.011) cleavage. DDDK-IVGG.

cDNA, FLJ92487, Homo sapiens protease, serine, 1 (trypsin 1) (PRSS1), mRNA is proteolytically cut by chymotrypsin C (S01.157) cleavage. IEVL-EGNE.

cDNA, FLJ92487, Homo sapiens protease, serine, 1 (trypsin 1) (PRSS1), mRNA is proteolytically cut by penicillopepsin (A01.011) cleavage. DDDK-IVGG.

cDNA, FLJ92487, Homo sapiens protease, serine, 1 (trypsin 1) (PRSS1), mRNA is proteolytically cut by cationic trypsin (S01.127) cleavage. INAR-VSTI.