Synaptosomal-associated protein 25

UniProt : P60881, UniProt ID: SNP25_RAT,

Synaptosomal-associated protein 25

Rattus norvegicus

MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERI
EEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARV
VDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDR
IMEKADSNKTRIDEANQRATKMLGSG

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Synaptosomal-associated protein 25 contains a PF05739 domain.

Synaptosomal-associated protein 25 contains a PF00835 domain.

Synaptosomal-associated protein 25 is proteolytically cut by bontoxilysin (M27.002) cleavage. EANQ-RATK.

Synaptosomal-associated protein 25 is proteolytically cut by bontoxilysin (M27.002) cleavage. QIDR-IMEK.

Synaptosomal-associated protein 25 is proteolytically cut by bontoxilysin (M27.002) cleavage. ANQR-ATKM.

Synaptosomal-associated protein 25 is proteolytically cut by bontoxilysin (M27.002) cleavage. QIDR-IMEK.