Bacteriocin sakacin-A

UniProt : P0A310, UniProt ID: SAKA_LACSK,

Bacteriocin sakacin-A

Lactobacillus sakei

MNNVKELSMTELQTITGGARSYGNGVYCNNKKCWVNRGEATQSIIGGMISGWASGLAGM

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Bacteriocin sakacin-A contains a PF01721 domain.

Bacteriocin sakacin-A is proteolytically cut by bacteriocin-processing peptidase (C39.001) cleavage. ITGG-ARSY.