Bacteriocin carnobacteriocin-A

UniProt : P38578, UniProt ID: CBA_CARPI,

Bacteriocin carnobacteriocin-A

Carnobacterium piscicola

MNNVKELSIKEMQQVTGGDQMSDGVNYGKGSSLSKGGAKCGLGIVGGLATIPSGPLGWLA
GAAGVINSCMK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Bacteriocin carnobacteriocin-A is proteolytically cut by bacteriocin-processing peptidase (C39.001) cleavage. VTGG-DQMS.