Interferon beta 1, fibroblast

UniProt : P01575, Q0VE17, UniProt ID: IFNB_MOUSE, Q0VE17_MOUSE,

Interferon beta 1, fibroblast

Mus musculus

MNNRWILHAAFLLCFSTTALSINYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIP
MEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLE
EKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNF
QN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Interferon beta 1, fibroblast contains a PF00143 domain.

Interferon beta 1, fibroblast is proteolytically cut by () cleavage..