Orexin
UniProt : O43612, UniProt ID: OREX_HUMAN, Orexin Homo sapiens MNLPSTKVSWAAVTLLLLLLLLPPALLSSGAAAQPLPDCCRQKTCSCRLYELLHGAGNHA AGILTLGKRRSGPPGLQGRLQRLLQASGNHAAGILTMGRRAGAEPAPRPCLGRRCSAPAA ASVAPGGQSGI The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Orexin contains a PF02072 domain.
Orexin is proteolytically cut by () cleavage..