cDNA, FLJ94076, Homo sapiens proteasome (prosome, macropain) 26S subunit, ATPase, 3(PSMC3), mRNA (Proteasome (Prosome, macropain) 26S subunit, ATPase, 3)

UniProt : B2R8V1, P17980, UniProt ID: B2R8V1_HUMAN, PRS6A_HUMAN,

cDNA, FLJ94076, Homo sapiens proteasome (prosome, macropain) 26S subunit, ATPase, 3(PSMC3), mRNA (Proteasome (Prosome, macropain) 26S subunit, ATPase, 3)

Homo sapiens

MNLLPNIESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIIQRTRLLDSEIKIMKSEVL
RVTHELQAMKDKIKENSEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGK
CAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEVDER
PTEQYSDIGGLDKQIQELVEAIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLARAC
AAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEK
AGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEE
ARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGMIALRRGATELTHEDY
MEGILEVQAKKKANLQYYA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ94076, Homo sapiens proteasome (prosome, macropain) 26S subunit, ATPase, 3(PSMC3), mRNA (Proteasome (Prosome, macropain) 26S subunit, ATPase, 3) contains a PF00004 domain.

cDNA, FLJ94076, Homo sapiens proteasome (prosome, macropain) 26S subunit, ATPase, 3(PSMC3), mRNA (Proteasome (Prosome, macropain) 26S subunit, ATPase, 3) is proteolytically cut by caspase () cleavage. AEQD-GIGE.