cDNA, FLJ95127, Homo sapiens synaptosomal-associated protein, 25kDa (SNAP25),transcript variant 2, mRNA (Synaptosomal-associated protein, 25kDa, isoform CRA_d)

UniProt : B2RAU4, P60880, UniProt ID: B2RAU4_HUMAN, SNP25_HUMAN,

cDNA, FLJ95127, Homo sapiens synaptosomal-associated protein, 25kDa (SNAP25),transcript variant 2, mRNA (Synaptosomal-associated protein, 25kDa, isoform CRA_d)

Homo sapiens

MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERI
EEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARV
VDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDR
IMEKADSNKTRIDEANQRATKMLGSG

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ95127, Homo sapiens synaptosomal-associated protein, 25kDa (SNAP25),transcript variant 2, mRNA (Synaptosomal-associated protein, 25kDa, isoform CRA_d) contains a PF00835 domain.

cDNA, FLJ95127, Homo sapiens synaptosomal-associated protein, 25kDa (SNAP25),transcript variant 2, mRNA (Synaptosomal-associated protein, 25kDa, isoform CRA_d) contains a PF05739 domain.

cDNA, FLJ95127, Homo sapiens synaptosomal-associated protein, 25kDa (SNAP25),transcript variant 2, mRNA (Synaptosomal-associated protein, 25kDa, isoform CRA_d) is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. EQMA-ISGG.

cDNA, FLJ95127, Homo sapiens synaptosomal-associated protein, 25kDa (SNAP25),transcript variant 2, mRNA (Synaptosomal-associated protein, 25kDa, isoform CRA_d) is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. EQMA-ISGG.

cDNA, FLJ95127, Homo sapiens synaptosomal-associated protein, 25kDa (SNAP25),transcript variant 2, mRNA (Synaptosomal-associated protein, 25kDa, isoform CRA_d) is proteolytically cut by calpain-2 (C02.002) cleavage..

cDNA, FLJ95127, Homo sapiens synaptosomal-associated protein, 25kDa (SNAP25),transcript variant 2, mRNA (Synaptosomal-associated protein, 25kDa, isoform CRA_d) is proteolytically cut by caspase-3 (C14.003) cleavage..

cDNA, FLJ95127, Homo sapiens synaptosomal-associated protein, 25kDa (SNAP25),transcript variant 2, mRNA (Synaptosomal-associated protein, 25kDa, isoform CRA_d) is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. EQMA-ISGG.

cDNA, FLJ95127, Homo sapiens synaptosomal-associated protein, 25kDa (SNAP25),transcript variant 2, mRNA (Synaptosomal-associated protein, 25kDa, isoform CRA_d) is proteolytically cut by calpain-2 (C02.002) cleavage..

cDNA, FLJ95127, Homo sapiens synaptosomal-associated protein, 25kDa (SNAP25),transcript variant 2, mRNA (Synaptosomal-associated protein, 25kDa, isoform CRA_d) is proteolytically cut by caspase-3 (C14.003) cleavage..

cDNA, FLJ95127, Homo sapiens synaptosomal-associated protein, 25kDa (SNAP25),transcript variant 2, mRNA (Synaptosomal-associated protein, 25kDa, isoform CRA_d) is proteolytically cut by bontoxilysin (M27.002) cleavage..

cDNA, FLJ95127, Homo sapiens synaptosomal-associated protein, 25kDa (SNAP25),transcript variant 2, mRNA (Synaptosomal-associated protein, 25kDa, isoform CRA_d) is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. EQMA-ISGG.

cDNA, FLJ95127, Homo sapiens synaptosomal-associated protein, 25kDa (SNAP25),transcript variant 2, mRNA (Synaptosomal-associated protein, 25kDa, isoform CRA_d) is proteolytically cut by calpain-2 (C02.002) cleavage..

cDNA, FLJ95127, Homo sapiens synaptosomal-associated protein, 25kDa (SNAP25),transcript variant 2, mRNA (Synaptosomal-associated protein, 25kDa, isoform CRA_d) is proteolytically cut by caspase-3 (C14.003) cleavage..

cDNA, FLJ95127, Homo sapiens synaptosomal-associated protein, 25kDa (SNAP25),transcript variant 2, mRNA (Synaptosomal-associated protein, 25kDa, isoform CRA_d) is proteolytically cut by bontoxilysin (M27.002) cleavage..

cDNA, FLJ95127, Homo sapiens synaptosomal-associated protein, 25kDa (SNAP25),transcript variant 2, mRNA (Synaptosomal-associated protein, 25kDa, isoform CRA_d) is proteolytically cut by bontoxilysin (M27.002) cleavage. QIDR-IMEK.