Lantibiotic mutacin-2

UniProt : O54329, UniProt ID: LANA_STRMU,

Lantibiotic mutacin-2

Streptococcus mutans

MNKLNSNAVVSLNEVSDSELDTILGGNRWWQGVVPTVSYECRMNSWQHVFTCC

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Lantibiotic mutacin-2 contains a PF04604 domain.

Lantibiotic mutacin-2 is proteolytically cut by bacteriocin-processing peptidase (C39.001) cleavage. ILGG-NRWW.