Adhesin AIDA-I

UniProt : Q03155, UniProt ID: AIDA_ECOLX,

Adhesin AIDA-I

Escherichia coli

MNKAYSIIWSHSRQAWIVASELARGHGFVLAKNTLLVLAVVSTIGNAFAVNISGTVSSGG
TVSSGETQIVYSGRGNSNATVNSGGTQIVNNGGKTTATTVNSSGSQNVGTSGATISTIVN
SGGIQRVSSGGVASATNLSGGAQNIYNLGHASNTVIFSGGNQTIFSGGITDSTNISSGGQ
QRVSSGGVASNTTINSSGAQNILSEEGAISTHISSGGNQYISAGANATETIVNSGGFQRV
NSGAVATGTVLSGGTQNVSSGGSAISTSVYNSGVQTVFAGATVTDTTVNSGGNQNISSGG
IVSETTVNVSGTQNIYSGGSALSANIKGSQIVNSEGTAINTLVSDGGYQHIRNGGIASGT
IVNQSGYVNISSGGYAESTIINSGGTLRVLSDGYARGTILNNSGRENVSNGGVSYNAMIN
TGGNQYIYSDGEATAAIVNTSGFQRINSGGTAPVQNSVVVTRTVSSAAKPFDAEVYSGGK
QTVYLWRGIWYSNFLTAVWSMFPGTASGANVNLSGRLNAFAGNVVGTILNQEGRQYVYSG
ATATSTVGNNEGREYVLSGGITDGTVLNSGGLQAVSSGGKASATVINEGGAQFVYDGGQV
TGTNIKNGGTIRVDSGASALNIALSSGGNLFTSTGATLPELTTMAALSVSQNHASNIVLE
NGGLLRVTSGGTATDTTVNSAGRLRIDDGGTINGTTTINADGIVAGTNIQNDGNFILNLA
ENYDFETELSGSGVLVKDNTGIMTYAGTLTQAQGVNVKNGGIIFDSAVVNADMAVNQNAY
INISDQATINGSVNNNGSIVINNSIINGNITNDADLSFGTAKLLSATVNGSLVNNKNIIL
NPTKESAGNTLTVSNYTGTPGSVISLGGVLEGDNSLTDRLVVKGNTSGQSDIVYVNEDGS
GGQTRDGINIISVEGNSDAEFSLKNRVVAGAYDYTLQKGNESGTDNKGWYLTSHLPTSDT
RQYRPENGSYATNMALANSLFLMDLNERKQFRAMSDNTQPESASVWMKITGGISSGKLND
GQNKTTTNQFINQLGGDIYKFHAEQLGDFTLGIMGGYANAKGKTINYTSNKAARNTLDGY
SVGVYGTWYQNGENATGLFAETWMQYNWFNASVKGDGLEEEKYNLNGLTASAGGGYNLNV
HTWTSPEGITGEFWLQPHLQAVWMGVTPDTHQEDNGTVVQGAGKNNIQTKAGIRASWKVK
STLDKDTGRRFRPYIEANWIHNTHEFGVKMSDDSQLLSGSRNQGEIKTGIEGVITQNLSV
NGGVAYQAGGHGSNAISGALGIKYSF

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Adhesin AIDA-I contains a PF03212 domain.

Adhesin AIDA-I contains a PF03797 domain.

Adhesin AIDA-I is proteolytically cut by omptin (A26.001) cleavage. LKNR-VVAG.