Isoform SNAP-25a of Synaptosomal-associated protein 25

UniProt : P60880, Q5U0B5, UniProt ID: P60880-2, Q5U0B5_HUMAN,

Isoform SNAP-25a of Synaptosomal-associated protein 25

Homo sapiens

MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRV
EEGMNHINQDMKEAEKNLKDLGKCCGLFICPCNKLKSSDAYKKAWGNNQDGVVASQPARV
VDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDR
IMEKADSNKTRIDEANQRATKMLGSG

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform SNAP-25a of Synaptosomal-associated protein 25 contains a PF05739 domain.

Isoform SNAP-25a of Synaptosomal-associated protein 25 contains a PF00835 domain.

Isoform SNAP-25a of Synaptosomal-associated protein 25 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. EQMA-ISGG.

Isoform SNAP-25a of Synaptosomal-associated protein 25 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. EQMA-ISGG.

Isoform SNAP-25a of Synaptosomal-associated protein 25 is proteolytically cut by Clostridal neurotoxins () cleavage..