Prolactin

UniProt : P01236, Q5THQ0, UniProt ID: PRL_HUMAN, Q5THQ0_HUMAN,

Prolactin

Homo sapiens

MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNL
SSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWN
EPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSG
LPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Prolactin contains a PF00103 domain.

Prolactin is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. LPSL-QMAD.

Prolactin is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. LPSL-QMAD.

Prolactin is proteolytically cut by cathepsin D (A01.009) cleavage. GMEL-IVSQ.

Prolactin is proteolytically cut by cathepsin D (A01.009) cleavage. NEIY-PVWS.

Prolactin is proteolytically cut by cathepsin D (A01.009) cleavage. YPVW-SGLP.

Prolactin is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. FITK-AINS.

Prolactin is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. LPSL-QMAD.

Prolactin is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. LPSL-QMAD.

Prolactin is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. APEA-ILSK.

Prolactin is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. LPSL-QMAD.

Prolactin is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. LPSL-QMAD.