Hyalophora cecropia

MNFSRIFFFTVFACLTALAMVNAAPEPKWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQAQ
IAKG

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

is proteolytically cut by inhA g.p. (M06.001) cleavage. KWKL-FKKI.

is proteolytically cut by inhA g.p. (M06.001) cleavage. LFKK-IEKV.

is proteolytically cut by inhA g.p. (M06.001) cleavage. EKVG-QRVR.

is proteolytically cut by inhA g.p. (M06.001) cleavage. KVGQ-NIRD.

is proteolytically cut by inhA g.p. (M06.001) cleavage. KIEK-VGQR.

is proteolytically cut by inhA g.p. (M06.001) cleavage. VGQN-IRDG.

is proteolytically cut by inhA g.p. (M06.001) cleavage. IRDG-IIKA.

is proteolytically cut by inhA g.p. (M06.001) cleavage. IIKA-GPAV.

is proteolytically cut by inhA g.p. (M06.001) cleavage. AVAV-VGQA.

is proteolytically cut by inhA g.p. (M06.001) cleavage. PAVA-VVGQ.