Thermopsin

UniProt : P17118, UniProt ID: THPS_SULAC,

Thermopsin

Sulfolobus acidocaldarius

MNFKSICLIILLSALIIPYIPQNIYFFPHRNTTGATISSGLYVNPYLYYTSPPAPAGIAS
FGLYNYSGNVTPYVITTNEMLGYVNITSLLAYNREALRYGVDPYSATLQFNIVLSVNTSN
GVYAYWLQDVGQFQTNKNSLTFIDNVWNLTGSLSTLSSSAITGNGQVASAGGGQTFYYDV
GPSYTYSFPLSYIYIINMSYTSNAVYVWIGYEIIQIGQTEYGTVNYYDKITIYQPNIISA
SLMINGNNYTPNGLYYDAELVWGGGGNGAPTSFNSLNCTLGLYYISNGSITPVPSLYTFG
ADTAEAAYNVYTTMNNGVPIAYNGIENLTILTNNFSVILI

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Thermopsin contains a PF05317 domain.

Thermopsin is proteolytically cut by thermopsin (A05.001) cleavage. SSGL-YVNP.