Dynamin-like GTPase MGM1, mitochondrial

UniProt : P32266, UniProt ID: MGM1_YEAST,

Dynamin-like GTPase MGM1, mitochondrial

Saccharomyces cerevisiae

MNASPVRLLILRRQLATHPAILYSSPYIKSPLVHLHSRMSNVHRSAHANALSFVITRRSI
SHFPKIISKIIRLPIYVGGGMAAAGSYIAYKMEEASSFTKDKLDRIKDLGESMKEKFNKM
FSGDKSQDGGHGNDGTVPTATLIAATSLDDDESKRQGDPKDDDDEDDDDEDDENDSVDTT
QDEMLNLTKQMIEIRTILNKVDSSSAHLTLPSIVVIGSQSSGKSSVLESIVGREFLPKGS
NMVTRRPIELTLVNTPNSNNVTADFPSMRLYNIKDFKEVKRMLMELNMAVPTSEAVSEEP
IQLTIKSSRVPDLSLVDLPGYIQVEAADQPIELKTKIRDLCEKYLTAPNIILAISAADVD
LANSSALKASKAADPKGLRTIGVITKLDLVDPEKARSILNNKKYPLSMGYVGVITKTPSS
INRKHLGLFGEAPSSSLSGIFSKGQHGQSSGEENTNGLKQIVSHQFEKAYFKENKKYFTN
CQVSTKKLREKLIKILEISMSNALEPTSTLIQQELDDTSYLFKVEFNDRHLTPKSYLLNN
IDVLKLGIKEFQEKFHRNELKSILRAELDQKVLDVLATRYWKDDNLQDLSSSKLESDTDM
LYWHKKLELASSGLTKMGIGRLSTMLTTNAILKELDNILESTQLKNHELIKDLVSNTAIN
VLNSKYYSTADQVENCIKPFKYEIDLEERDWSLARQHSINLIKEELRQCNSRYQAIKNAV
GSKKLANVMGYLENESNLQKETLGMSKLLLERGSEAIFLDKRCKVLSFRLKMLKNKCHST
IEKDRCPEVFLSAVSDKLTSTAVLFLNVELLSDFFYNFPIELDRRLTLLGDEQVEMFAKE
DPKISRHIELQKRKELLELALEKIDSILVFKKSYKGVSKNL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Dynamin-like GTPase MGM1, mitochondrial contains a PF00350 domain.

Dynamin-like GTPase MGM1, mitochondrial is proteolytically cut by Pcp1 protein (S54.007) cleavage. TVPT-ATLI.