Fimbrial protein 1

UniProt : P20657, UniProt ID: FMI_MORBO,

Fimbrial protein 1

Moraxella bovis

MNAQKGFTLIELMIVIAIIGILAAIALPAYQDYISKSQTTRVSGELAAGKTAVDAALFEG
KTPVLSEESSTSKENIGLTSSETSTKPRSNLMASVELTGFADNGAGTISATLGNKANKDI
AKTVITQERTTDGVWTCKIDGSQAAKYKEKFNPTGCVKK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Fimbrial protein 1 contains a PF00114 domain.

Fimbrial protein 1 contains a PF07963 domain.

Fimbrial protein 1 is proteolytically cut by type 4 prepilin peptidase 1 (A24.001) cleavage. AQKG-FTLI.