cDNA, FLJ92075, Homo sapiens chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (CXCL12), mRNA

UniProt : B2R4G0, P48061, UniProt ID: B2R4G0_HUMAN, SDF1_HUMAN,

cDNA, FLJ92075, Homo sapiens chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (CXCL12), mRNA

Homo sapiens

MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIV
ARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ92075, Homo sapiens chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (CXCL12), mRNA contains a PF00048 domain.

cDNA, FLJ92075, Homo sapiens chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (CXCL12), mRNA is proteolytically cut by dipeptidyl-peptidase IV (S09.003) cleavage. DGKP-VSLS.

cDNA, FLJ92075, Homo sapiens chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (CXCL12), mRNA is proteolytically cut by cathepsin G (S01.133) cleavage. PVSL-SYRC.

cDNA, FLJ92075, Homo sapiens chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (CXCL12), mRNA is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. KPVS-LSYR.

cDNA, FLJ92075, Homo sapiens chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (CXCL12), mRNA is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. KPVS-LSYN.

cDNA, FLJ92075, Homo sapiens chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (CXCL12), mRNA is proteolytically cut by neutrophil elastase (S01.131) cleavage..