Stromal cell-derived factor 1 gamma

UniProt : Q5IT36, UniProt ID: Q5IT36_HUMAN,

Stromal cell-derived factor 1 gamma

Homo sapiens

MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIV
ARLKNNNRQVCIDPKLKWIQEYLEKALNKGRREEKVGKKEKIGKKKRQKKRKAAQKRKN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Stromal cell-derived factor 1 gamma contains a PF00048 domain.

Stromal cell-derived factor 1 gamma is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. KPVS-LSYR.