Isoform Alpha of Stromal cell-derived factor 1

UniProt : P48061, Q6ICW0, UniProt ID: P48061-2, Q6ICW0_HUMAN,

Isoform Alpha of Stromal cell-derived factor 1

Homo sapiens

MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIV
ARLKNNNRQVCIDPKLKWIQEYLEKALNK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform Alpha of Stromal cell-derived factor 1 contains a PF00048 domain.

Isoform Alpha of Stromal cell-derived factor 1 is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. KPVS-LSYR.

Isoform Alpha of Stromal cell-derived factor 1 is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. KPVS-LSYN.

Isoform Alpha of Stromal cell-derived factor 1 is proteolytically cut by dipeptidyl-peptidase IV (S09.003) cleavage. DGKP-VSLS.

Isoform Alpha of Stromal cell-derived factor 1 is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. KPVS-LSYR.