Hepatocyte growth factor

UniProt : P17945, UniProt ID: HGF_RAT,

Hepatocyte growth factor

Rattus norvegicus

MMWGTKLLPVLLLQHVLLHLLLLPVTIPYAEGQKKRRNTLHEFKKSAKTTLTKEDPLVKI
KTKKVNSADECANRCIRNKGFPFTCKAFVFDKSRKRCYWYPFNSMSSGVKKGFGHEFDLY
ENKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRN
PRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKTCQRWDQQT
PHRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKMCAHSAVNETDVP
METTECIKGQGEGYRGTTNTIWNGIPCQRWDSQYPHKHDITPENFKCKDLRENYCRNPDG
AESPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWDKNM
EDLHRHIFWEPDASKLTKNYCRNPDDDAHGPWCYTGNPLVPWDYCPISRCEGDTTPTIVN
LDHPVISCAKTKQLRVVNGIPTQTTVGWMVSLKYRNKHICGGSLIKESWVLTARQCFPAR
NKDLKDYEAWLGIHDVHERGEEKRKQILNISQLVYGPEGSDLVLLKLARPAILDNFVSTI
DLPSYGCTIPEKTTCSIYGWGYTGLINADGLLRVAHLYIMGNEKCSQHHQGKVTLNESEL
CAGAEKIGSGPCEGDYGGPLICEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIH
KVILTYKL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Hepatocyte growth factor contains a PF00051 domain.

Hepatocyte growth factor contains a PF00089 domain.

Hepatocyte growth factor contains a PF00051 domain.

Hepatocyte growth factor contains a PF00051 domain.

Hepatocyte growth factor contains a PF00051 domain.

Hepatocyte growth factor contains a PF00024 domain.

Hepatocyte growth factor is proteolytically cut by hepatocyte growth factor activator (S01.228) cleavage. KQLR-VVNG.