Treacle protein

UniProt : O08784, UniProt ID: TCOF_MOUSE,

Treacle protein

Mus musculus

MAEARKRRELLPLIYHHLLQAGYVRAAREVKEQSGQKSFLTQPVTLLDIYTHWQQTSELG
QKQKAEDDETLQAKKSRVSDPVSSSESSDQEKEEEAATERAKATPRPTPVNSATAALPSK
VKEKGKTKTANKTVNSVSHPGSGKTVVHLLSGKSPKKSAEPLANTVLASETEEEGNAQAL
GPTAKSGTVSAGQGSSSSEDSSISSDETDVEVKSPAKPAQAKASAAPAKDPPARTAPGPT
KLGNVAPTPAKPARAAAAAAAAAVAAAAAAAAEESESSEEDSDSEDEAPAGLPSQVKASG
KGPHVRADSVSAKGISGKGPILATPGKTGPAATQAKAERPEKDSETSSEDDSDSEDEMPV
TVNTPQARTSGKSPRARGTSAPAKESSQKGAPAVTPGKARPVAAQAGKPEAKSSEESESD
SGETPAAATLTTSPAKVKPLGKSSQVRPVSTVTPGSSGKGANLPCPGKVGSAALRVQMVK
KEDVSESSSAELDSDGPGSPAKAKASLALPQKVRPVATQVKTDRGKGHSGSSEESSDSEE
EAAPAASAAQAKPALEKQMKASSRKGTPASATGASTSSHCKAGAVTSSASLSSPALAKGT
QRSDVDSSSESESEGAAPSTPRVQGKSGGKGLQGKAALGQGVAPVHTQKTGPSVKAMAQE
DSESLEEDSSSEEEDETPAQATPLGRLPQAKANPPPTKTPPASASGKAVAAPTKGKPPVP
NSTVSARGQRSVPAAGKAGAPATQAQKGPVAGTGEDSESSSKEESDSEEETPAQIKPVGK
TSQVRAASAPAKESPKKGAHPGTPGKTGSSATQAQPGKTEDSDSSSEESDSDTEMPSAQA
IKSPPVSVNRNSSPAVPAPTPEGVQAVNTTKKASGTTAQSSSSESEDGDEDLIPATQPST
YALRTSVTTPAALSRAASQPSKSEQSSRMPKGKKAKAAASAQTSSAVETLPMMPPQSAPI
QPKATNKLGKSKLPEKQQLAPGYPKAPRSSEDSSDTSSEDEEDAKRPQMPKSAHRLDPDP
SQKETVVEETPTESSEDEMVAPSQSLLSGYMTPGLTVANSQASKATPRPDSNSLASSAPA
TKDNPDGKQKSKSQHAADTALPKTGRKEASSGSTPQKPKKLKKSTSSSPAPTQTLPNSIT
QRLLEQAWPLSEAQVQASVVKVLTELLEQERLKATEAIKESGKKSQKRKLSGDLEAGAPK
NKKKKEQPVPRASAVSPEKAPMTSKAKSKLDKGSAGGKGKGSPGPQGAKEKPDGELLGIK
LESGEQSDPKSKSKKKKSLKKKKDKEKKEKKKGKKSLAKDSASPIQKKKKKKKKSAEPAV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Treacle protein contains a PF03546 domain.

Treacle protein contains a PF03546 domain.

Treacle protein is proteolytically cut by caspase-1 (C14.001) cleavage. SASL-SSPA.